PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG196000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 336aa    MW: 37001 Da    PI: 7.2749
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG196000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1806.1e-5651301128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeelv++yL++kv++  + + ++i++vd++k+ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdk
  Pavir.9NG196000.1.p   5 LPPGFRFHPTDEELVTYYLTRKVSDFAFAT-RAIADVDLNKCEPWDLPGKASMGEKEWYFFSMRDRKYPTGIRTNRATASGYWKTTGKDK 93 
                          79*************************999.89***************988999************************************ PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          e+++  g lvg+kktLvfy+grapkgekt+Wvmheyrl
  Pavir.9NG196000.1.p  94 EIFH-CGMLVGMKKTLVFYRGRAPKGEKTSWVMHEYRL 130
                          ****.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-643151IPR003441NAC domain
PROSITE profilePS5100560.1975151IPR003441NAC domain
PfamPF023652.1E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELVT YYLTRKVSDF AFATRAIADV DLNKCEPWDL PGKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TASGYWKTTG KDKEIFHCGM LVGMKKTLVF YRGRAPKGEK  120
TSWVMHEYRL QNKFPYKPNK EEWVVCRVFK KCQIIKMRPP QGSPTMDDSP CHDANASLGE  180
LGELDVSSIL GGFTPSAAHT SSTSSPGALH QGAGESFGHR VDMNAYMSWM AAANHGAAAA  240
AAAVMLPWAT TPGLFGNVFA PNHQQLALQK PLPFVAGCSQ PRDLAGFAAN VGSEHDAMFA  300
SSLAKVEMEC DQQQPAPTPT PEQQLGMDES TWRAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-57515117165NO APICAL MERISTEM PROTEIN
1ut4_B5e-57515117165NO APICAL MERISTEM PROTEIN
1ut7_A5e-57515117165NO APICAL MERISTEM PROTEIN
1ut7_B5e-57515117165NO APICAL MERISTEM PROTEIN
3swm_A6e-57515120168NAC domain-containing protein 19
3swm_B6e-57515120168NAC domain-containing protein 19
3swm_C6e-57515120168NAC domain-containing protein 19
3swm_D6e-57515120168NAC domain-containing protein 19
3swp_A6e-57515120168NAC domain-containing protein 19
3swp_B6e-57515120168NAC domain-containing protein 19
3swp_C6e-57515120168NAC domain-containing protein 19
3swp_D6e-57515120168NAC domain-containing protein 19
4dul_A5e-57515117165NAC domain-containing protein 19
4dul_B5e-57515117165NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.323230.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982400.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK4ACC80.0K4ACC8_SETIT; Uncharacterized protein
STRINGSi036535m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.14e-93NAC domain containing protein 58